PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK09018.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRAS
Protein Properties Length: 543aa    MW: 60996.1 Da    PI: 5.9044
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK09018.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS442.82.4e-1351715422373
       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqa 101
                +++L+ cAeavs+++   a++l+ +l++++s +g+p+qRl ay++e+L a+ a s+s+++k+l+++e +   sse l+++++++e++P++kf+++ aN a
  PK09018.1 171 KQVLICCAEAVSDNNVLVAERLMDELRQMVSVSGEPIQRLGAYMLEGLVAKFAFSGSNICKSLKCKEPA---SSELLSYMHILYELCPYFKFGYMSANGA 267
                689*****************************************************************9...9*************************** PP

       GRAS 102 IleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpg 199
                I ea++ e+rvHiiDf+i+qG QW++L+qa+a+Rp+gpp++RiTg++++ s   +   l+ +g++L++fAe+++vpfef+  vak+ ++++l +L v+p+
  PK09018.1 268 IAEAMKDENRVHIIDFQIGQGSQWITLIQAFAARPGGPPHIRITGIDDSVSAyaRGGGLSIVGKKLSRFAETFKVPFEFHS-VAKSGSEVQLADLVVRPD 366
                ************************************************888899999************************.7***************** PP

       GRAS 200 EalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres...eerikvErellgreivn 296
                E laVn++++lh+++desvs++++rd++L+lvkslsPkvv++veqe+++n++ F+ rf+e+l+yy+a+f+s++++lpr++   +eri+vE+++l+re+vn
  PK09018.1 367 EGLAVNFAFMLHHMPDESVSTQNHRDRLLRLVKSLSPKVVTLVEQESNTNTAAFFPRFVETLDYYAAMFESIDVTLPRHHkehKERINVEQHCLAREVVN 466
                *****************************************************************************9988889**************** PP

       GRAS 297 vvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                ++aceg+er+erhe l+kW++r+++aGF+p+pls+ +++++k+ll+++ ++ y++ee++g+l+lgW++r Lv+ SaW
  PK09018.1 467 IIACEGTERVERHELLGKWKSRFKMAGFTPYPLSTLVNATIKTLLENYCNK-YKLEERDGALYLGWMNRYLVTSSAW 542
                *************************************************66.************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098567.425144524IPR005202Transcription factor GRAS
PfamPF035148.3E-133171542IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0005737Cellular Componentcytoplasm
GO:0004871Molecular Functionsignal transducer activity
Sequence ? help Back to Top
Protein Sequence    Length: 543 aa     Download sequence    Send to blast
MANRLYYQPP IQDVESYCLP QFRSLDGEVC YSNSSRSQGG AQVLAKNSFH LYSTLESSPA  60
NENCNMYISP STVSFSPSGS PISQQDSHSY LPDQRNSPEN TYGSPISGSC ITDDMSDWKY  120
KLKELESAML GPDLSIQDSY DTDVQRLANN SSNEIESWGQ IMEPIFKRDV KQVLICCAEA  180
VSDNNVLVAE RLMDELRQMV SVSGEPIQRL GAYMLEGLVA KFAFSGSNIC KSLKCKEPAS  240
SELLSYMHIL YELCPYFKFG YMSANGAIAE AMKDENRVHI IDFQIGQGSQ WITLIQAFAA  300
RPGGPPHIRI TGIDDSVSAY ARGGGLSIVG KKLSRFAETF KVPFEFHSVA KSGSEVQLAD  360
LVVRPDEGLA VNFAFMLHHM PDESVSTQNH RDRLLRLVKS LSPKVVTLVE QESNTNTAAF  420
FPRFVETLDY YAAMFESIDV TLPRHHKEHK ERINVEQHCL AREVVNIIAC EGTERVERHE  480
LLGKWKSRFK MAGFTPYPLS TLVNATIKTL LENYCNKYKL EERDGALYLG WMNRYLVTSS  540
AWN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-651705434375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010112792.10.0hypothetical protein L484_020023
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLW9SM100.0W9SM10_9R
STRINGPOPTR_0014s16230.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16533497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein